PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.F2CY5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 853aa    MW: 94506.5 Da    PI: 5.2916
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.F2CY5genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox566.7e-1851106156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  +++ +++t++q++e+e++F+ +++p++++r eL + lgL+  q+k+WFqN+R++ k
  Aradu.F2CY5  51 KKRYQRHTPYQIQEMETFFKACPHPDEQQRIELGNVLGLDHLQIKFWFQNKRTQLK 106
                  688999**********************************************9988 PP

2START1593.5e-503755972206
                  HHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECT CS
        START   2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetleviss 87 
                  la + ++el ++++a+ep+Wv+ +   e  n++e++++f+ + +     +++e +r+s+v  m++++lve+l d+   W++ +     ka+  +v+s+
  Aradu.F2CY5 375 LAAASLEELKALVQAGEPMWVSGAhnsETINEQEYYRTFPGGIGprllgYKSESSRESRVINMNHVNLVEILNDVD-LWSRVFCsivsKAAGFQVLST 471
                  67889999****************9988899********88888****************************9999.*****999999********** PP

                  T......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCE.EEEEEEE-EE--SSXX CS
        START  88 g......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksngh.skvtwvehvdlkgrlp 177
                  g      g lq+ ++e+q+++plvp R+++f+Ry+++l++g+wv+vd S++  q++ +  +  R  ++pSg+li+ +++g+ +kvtwvehv++++r  
  Aradu.F2CY5 472 GqagsydGNLQVVSSEFQMPTPLVPaREYYFLRYCKKLQDGRWVVVDASLETSQPNAT-IPPTR--RRPSGCLIQASPDGYsTKVTWVEHVEVDDRAL 566
                  *******************************************************995.44455..6**************99***********9954 PP

                  ..HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 178 ..hwllrslvksglaegaktwvatlqrqcek 206
                     +++++lv+sgla+ga++wva l+r ce+
  Aradu.F2CY5 567 mvNSMYKPLVESGLAFGARRWVAQLDRRCER 597
                  45***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.43E-1845110IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-1847113IPR009057Homeodomain-like
PROSITE profilePS5007115.62948108IPR001356Homeobox domain
SMARTSM003891.3E-1650112IPR001356Homeobox domain
CDDcd000863.36E-1651108No hitNo description
PfamPF000461.5E-1551106IPR001356Homeobox domain
PROSITE profilePS5084836.806365600IPR002913START domain
SuperFamilySSF559613.23E-29369599No hitNo description
CDDcd088752.22E-96369596No hitNo description
SMARTSM002341.4E-40374597IPR002913START domain
PfamPF018524.8E-42375597IPR002913START domain
Gene3DG3DSA:3.30.530.201.6E-7476592IPR023393START-like domain
SuperFamilySSF559612.51E-17622813No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 853 aa     Download sequence    Send to blast
MSNHSMMNNN SSGSDYFLRK ILEIQDFEVD TDSHANMQQP PPGYGSDHPK KKRYQRHTPY  60
QIQEMETFFK ACPHPDEQQR IELGNVLGLD HLQIKFWFQN KRTQLKNQYE RNENFALKNE  120
NEELRAENEN YKEILNSIRC HGCGGPPPPP LTYDQMRQEN NKLREQIEWM STMMSNCVLQ  180
EPDNTSNPNI TRPQNVPNIE SSQQNNTNNM MPQTQSVPNQ ELGNMASPPQ SNNIDILSPS  240
MFNQGIIDSM RLTQQNNGID MPQNVINHGI VKDMPSSQAH NNVINVTPPM SMLNQGIGDN  300
IAVIPPSVLD QGNCSVPSSS QHNNEIYINL PLSSLNQDVG SYGAKSKDKA GETSSGSDPL  360
IRSLPVSNKA MIEELAAASL EELKALVQAG EPMWVSGAHN SETINEQEYY RTFPGGIGPR  420
LLGYKSESSR ESRVINMNHV NLVEILNDVD LWSRVFCSIV SKAAGFQVLS TGQAGSYDGN  480
LQVVSSEFQM PTPLVPAREY YFLRYCKKLQ DGRWVVVDAS LETSQPNATI PPTRRRPSGC  540
LIQASPDGYS TKVTWVEHVE VDDRALMVNS MYKPLVESGL AFGARRWVAQ LDRRCERIAS  600
AVQTTTILQP QEDQLSVTSV EGKKGLVKLA ERMVMDFLSG VGASTVENWA IVTPSTNHSN  660
IRIITRKVED DPGRPSGIVI GAATCFHLAV PPNSFFDRVR TANARAEWDV LCTGGVAEEF  720
AHIKNGRDPG NCITLFRIKS PDAKNNGMII VQESSSDSTG SFVIYAPVDM NSINAVIGGR  780
DPDELPILPS GMAILPDGGG GCLVTLAFQI LIESDPTKKI SICSVSTINQ LVKVTVNNIK  840
ALFKTEEEPN ERI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015941575.10.0PREDICTED: homeobox-leucine zipper protein HDG2-like
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLA0A0B2RTP50.0A0A0B2RTP5_GLYSO; Homeobox-leucine zipper protein MERISTEM L1
TrEMBLA0A0R0HGN60.0A0A0R0HGN6_SOYBN; Uncharacterized protein
TrEMBLK7LMB00.0K7LMB0_SOYBN; Uncharacterized protein
STRINGGLYMA11G00570.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2943822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2